DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and rnf145l

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis


Alignment Length:342 Identity:76/342 - (22%)
Similarity:134/342 - (39%) Gaps:78/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MALTSAVIGFAYYQKQQFYPAVVYITKSNASMGVIYIQFFVIVFMFGKLLSKIFLGTLRAAEFEH 74
            :||.:.::.....|:......:::|..::....:|.|...::          :.||..|.     
 Frog   318 LALQTGLLDLQVLQRTFLLSIILFIVVTSTLQSMIEIADPIV----------LALGATRN----- 367

  Fly    75 LLERFWYAL--TETCLAFTVFRDDFNPRFVALFTVLLFLKSFHWLAEERVDFMERSPVLGWLFHI 137
              ...|..|  ...||...||     |.|:| :.:..|   ||      :||        ||..:
 Frog   368 --RSLWKHLRGVSMCLFLLVF-----PCFMA-YKISQF---FH------MDF--------WLLIL 407

  Fly   138 RVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILLTVIASTAIKYVLHAAEMRTDTP 202
            ....:||.|.:|..:.:...:...|.....|:.:   :..|......|..:::::....:...| 
 Frog   408 VSSCMLTSLQVLGTLFIYALFMVELFHDSQVEKI---DEIIYYVNAVSRVLEFLVAVCVVAYGT- 468

  Fly   203 WENKAVFLLYTELV-IGLIKVVLYILFVVIMAKIYALPMFVFRPMFFTIRNFRKALNDVIMSRRA 266
            ||:     |:.|.. :|:..::::..|.|.:........|:.|                   |.|
 Frog   469 WES-----LFGEWSWMGVSVIIVHSYFNVWLRAQSGWKSFLLR-------------------REA 509

  Fly   267 IRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLRSWFQRQQTCPTCRLNI 331
            .:.:::| |.||.|:||..:::|.||.:|| :.:...||.||||..|||.|...|.|||.|...:
 Frog   510 AKKISSL-PMATLEQLRAHNDVCPICFQDM-SGAVITPCSHIFHGECLRKWLYVQDTCPICHQQV 572

  Fly   332 LRTPTVNSTAMPRQGDE 348
              .|...:.   |:|:|
 Frog   573 --KPLAETL---REGEE 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 74/332 (22%)
zf-RING_2 287..328 CDD:290367 19/40 (48%)
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425 41/230 (18%)
zf-rbx1 <528..569 CDD:289448 19/41 (46%)
zf-RING_2 529..569 CDD:290367 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.