DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sip3 and rnf126

DIOPT Version :9

Sequence 1:NP_001263152.1 Gene:sip3 / 43747 FlyBaseID:FBgn0039875 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001076486.1 Gene:rnf126 / 100009648 ZFINID:ZDB-GENE-070209-292 Length:309 Species:Danio rerio


Alignment Length:87 Identity:23/87 - (26%)
Similarity:43/87 - (49%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 DVIMSRRAIRNMNTLYPDATPEELRQSDNI------------CIICREDMV--NHSKKLPCGHIF 309
            |.|:::...:..||..|.|..::::....:            |.:|:||..  .:.::|||.|:|
Zfish   184 DAIITQLLNQFENTGPPPADKDKIKSLPTVQIKQEHVGAGLECPVCKEDYSAGENVRQLPCNHLF 248

  Fly   310 HTTCLRSWFQRQQTCPTCRLNI 331
            |..|:..|.::..|||.||.::
Zfish   249 HNDCIVPWLEQHDTCPVCRKSL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sip3NP_001263152.1 HRD1 20..>365 CDD:227568 23/87 (26%)
zf-RING_2 287..328 CDD:290367 15/54 (28%)
rnf126NP_001076486.1 zinc_ribbon_9 10..40 CDD:291067
zf-RING_2 225..267 CDD:290367 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.