powered by:
Protein Alignment Smvt and CG34337
DIOPT Version :9
Sequence 1: | NP_651891.2 |
Gene: | Smvt / 43744 |
FlyBaseID: | FBgn0039873 |
Length: | 591 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096901.1 |
Gene: | CG34337 / 5740569 |
FlyBaseID: | FBgn0085366 |
Length: | 71 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 19/38 - (50%) |
Gaps: | 8/38 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 505 LFLG-STTEAP-------VGEKEFSILDLSFNWYTVTG 534
||:| |...|| .||.|.||.:|:.:...::|
Fly 15 LFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAMSG 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Smvt | NP_651891.2 |
SLC5sbd_NIS-SMVT |
27..548 |
CDD:271383 |
13/38 (34%) |
CG34337 | NP_001096901.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0591 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.