DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1910 and asph

DIOPT Version :9

Sequence 1:NP_651888.1 Gene:CG1910 / 43741 FlyBaseID:FBgn0022349 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_005163439.1 Gene:asph / 323659 ZFINID:ZDB-GENE-031112-5 Length:475 Species:Danio rerio


Alignment Length:390 Identity:109/390 - (27%)
Similarity:171/390 - (43%) Gaps:62/390 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KEKEKVQTSVKGKGAVKKDKKEVKKQ--EKATEKYAPEEAKEDVAEAKEEDASPAGVQDQPDGVE 182
            |:|..|:|....:.|..:..:|....  |:..:.|..|||.:...||.||:  |...:::|..|:
Zfish   108 KDKLTVETRETVQSATPEPVEEALDAIVEEEIQAYEAEEAAQSPPEAVEEE--PVAEEEEPLAVD 170

  Fly   183 NLPSVAEAKQNHVDEVKPISEEPGNSSEEVPKA--EEP-LKSSGETSENGAATETAAAPKEPASV 244
            ..|.|||   ..|.|.:|..||.....||.|:.  ||| |....:|.|.  |.|..|..:|..:|
Zfish   171 EEPVVAE---EEVTEEEPEVEEDLEVPEEEPEVIEEEPELPVEKQTFEE--AVEELATEEEVVAV 230

  Fly   245 MDVDEDETLVENTPSANKEKALDDEKEP-EQKSEEHAAAVLESKEQNEPAKEPTPEPMEVDGSSK 308
                 :|.:.|..|   .|:|:::|..| |:.:||.||.|.|..|..|.. .|..|.:|::    
Zfish   231 -----EEAVEEVAP---VEEAIEEEAAPVEEAAEEEAAPVEEPVEVFEEV-VPVEEAVELE---- 282

  Fly   309 GSSDTAQVDTPAIENVSAAPETEA-AAKTTESSNDVVEVATEGKETVLEVPAAEPKEAESTVESA 372
              .:.|..:..::|  .|||..|| .|:.|....:.|||..|..|.|:|.     :||...:||.
Zfish   283 --EEAAPEEKESVE--EAAPVEEALPAEETAPVEEAVEVEEEAVEEVVEA-----EEAVEELESV 338

  Fly   373 EELTETSTVVVTEPKEAASSEEEP---SKVVDSA--EPKEAESNTD----------ESATPVPID 422
            :|:.|  .:.|.||.|.....|||   ::.|:.|  ||::||...:          |.:.|....
Zfish   339 DEVEE--NLPVEEPVEDLEPVEEPVEETEQVEEAFEEPEQAEEPVEEIVEIPEEETEESVPTEET 401

  Fly   423 VSTAPASNDVSKPLEIDTTLVKTADSPAKEPQEI---------CEVKKAEINVNGEPKIVNSSAE 478
            |:....:.:|.:|::.:.......:..|:|..|:         .|..:.|.|....|:.:|.:.|
Zfish   402 VTKEDVTEEVDEPVQEEEEEQDFTEEEAEEEVEVEAENIEEEEYEAAEEEQNEEDIPEDINQTEE 466

  Fly   479  478
            Zfish   467  466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1910NP_651888.1 DUF4775 31..489 CDD:292620 109/390 (28%)
asphXP_005163439.1 Asp-B-Hydro_N 25..>129 CDD:191249 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.