DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1910 and SPBC1711.05

DIOPT Version :9

Sequence 1:NP_651888.1 Gene:CG1910 / 43741 FlyBaseID:FBgn0022349 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_595878.1 Gene:SPBC1711.05 / 2539687 PomBaseID:SPBC1711.05 Length:451 Species:Schizosaccharomyces pombe


Alignment Length:373 Identity:74/373 - (19%)
Similarity:155/373 - (41%) Gaps:54/373 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KKARTSPASATKASAGKGRGARKLDVGADEPEPELEKEKEKV-QTSVKGKGAVKKDKKEVKKQEK 147
            |.|:|...........||:..:.|        .:|..:||.: ..:.:..|..||.|:.::|...
pombe    25 KTAQTFLKETGDKDLAKGKVKKNL--------LDLLSQKEFLPYLTTEDVGKHKKTKESLEKSND 81

  Fly   148 ATEKYAPEEAKEDVAEAKEEDASPAGVQDQPDGVENLPSVAEAKQNHVDEVKPIS---EEPGNSS 209
            .::|.:.:.|..:.|.:..|.:......|:.|.     |.:|::.:..|.....|   .|..:||
pombe    82 DSQKISKKGAPPEKAHSSSEASGSGSSSDESDS-----SSSESESSSEDNDSSSSSSDSESESSS 141

  Fly   210 EEVPKAEEPLKSSGETSENGAATETAAAPKEPASVMDVDEDETLVENTPSANKEKALDDEKEPEQ 274
            |:...:.....|..|:|..|:.:.::::..|..|   ..||.....::..:..|.:.:|......
pombe   142 EDSDSSSSSSDSESESSSEGSDSSSSSSSSESES---SSEDNDSSSSSSDSESESSSEDSDSSSS 203

  Fly   275 KSEEHAAAVLESKEQNEPAKEPTPEPMEVDGSSKGSSDTAQVDTPAIENVSAA----PETEAAAK 335
            .|:..:.:..|..:.:..:.....|....|..|..||..::.::.:.::.|::    .|:|:::|
pombe   204 SSDSESESSSEGSDSSSSSSSSESESSSEDNDSSSSSSDSESESSSEDSDSSSSSSDSESESSSK 268

  Fly   336 TTESSNDVVEVATEGKETVLEVPAAEPKEAESTVESAEELTETSTVVVTEPKEAASSEEEPSKVV 400
            .::||::                 :...|.:|:.:|::..:|:|    :|..::.||..:..   
pombe   269 DSDSSSN-----------------SSDSEDDSSSDSSDSESESS----SEDSDSTSSSSDSD--- 309

  Fly   401 DSAEPKEAESNTDESATPVPIDVSTAPASNDVSKPLEIDTTLVKTADS 448
            .|:..::..||||   |....:||...::|..|..   ::|.||..||
pombe   310 SSSSSEDGNSNTD---TTTSGEVSAQSSTNSTSSE---ESTSVKDEDS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1910NP_651888.1 DUF4775 31..489 CDD:292620 74/373 (20%)
SPBC1711.05NP_595878.1 LisH 7..38 CDD:128913 3/12 (25%)
SRP40_C 381..445 CDD:282829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.