DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme3

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_445959.1 Gene:Nme3 / 85269 RGDID:619879 Length:169 Species:Rattus norvegicus


Alignment Length:170 Identity:102/170 - (60%)
Similarity:131/170 - (77%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGTILAFFSVI--SATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKEL 63
            |:..:|..|:.:  ||....| ||||:.||||||||.|||:|:.|||:|||||||||...||:||
  Rat     1 MICLVLTIFANLFPSAYSGVN-ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEEL 64

  Fly    64 LEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQV 128
            |.:||.:|..|||:..||.||.|||||.|||:||:||:..|.::|||:|.|:.|||||||||::|
  Rat    65 LREHYVELRERPFYSRLVKYMGSGPVVAMVWQGLDVVRASRALIGATDPGDATPGTIRGDFCVEV 129

  Fly   129 GRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 168
            |:|:|||||:||||::||||||.|.||:.|..:|..|:||
  Rat   130 GKNVIHGSDSVESAQREIALWFREDELLCWEDSAGHWLYE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 95/147 (65%)
NDK 21..155 CDD:278749 89/133 (67%)
Nme3NP_445959.1 NDK 22..156 CDD:278749 89/133 (67%)
NDPk_I 22..151 CDD:239876 86/128 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.