DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme2

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_114021.2 Gene:Nme2 / 83782 RGDID:619877 Length:152 Species:Rattus norvegicus


Alignment Length:151 Identity:117/151 - (77%)
Similarity:130/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVN 82
            ||.|||||.:|||||||||||:||:|||||||:|||:||..||:|.|::||.||..||||||||.
  Rat     2 ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVK 66

  Fly    83 YMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIA 147
            ||||||||.|||||||||||||.|||.||||||.|||||||||||||||||||||:||||||||.
  Rat    67 YMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIG 131

  Fly   148 LWFNEKELVTWTPAAKDWIYE 168
            |||..:||:.:...|.||:||
  Rat   132 LWFKPEELIDYKSCAHDWVYE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 114/147 (78%)
NDK 21..155 CDD:278749 108/133 (81%)
Nme2NP_114021.2 Interaction with AKAP13. /evidence=ECO:0000250|UniProtKB:P22392 1..66 47/63 (75%)
PTZ00093 3..151 CDD:173387 114/147 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2451
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I3209
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - otm44809
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - LDO PTHR11349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.