DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NDPK2

DIOPT Version :10

Sequence 1:NP_476761.3 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_568970.2 Gene:NDPK2 / 836451 AraportID:AT5G63310 Length:231 Species:Arabidopsis thaliana


Alignment Length:148 Identity:86/148 - (58%)
Similarity:109/148 - (73%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMN 85
            |.|:|||||||:||||||:||.|||:|||||:.||.....|||.|:||.||||:.|||.|:.|:.
plant    84 EETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYIT 148

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWF 150
            |||||.|.|||:.||.:.|:::|.|:|..:.|||||||..:|.||||:||||:.|:.::||.|||
plant   149 SGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWF 213

  Fly   151 NEKELVTWTPAAKDWIYE 168
            .|.||..|..|...|:.|
plant   214 KEGELCKWDSALATWLRE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_476761.3 PTZ00093 19..167 CDD:173387 85/145 (59%)
NDPK2NP_568970.2 NDPk_I 84..213 CDD:239876 77/128 (60%)

Return to query results.
Submit another query.