DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NDPK3

DIOPT Version :10

Sequence 1:NP_476761.3 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_192839.1 Gene:NDPK3 / 826702 AraportID:AT4G11010 Length:238 Species:Arabidopsis thaliana


Alignment Length:152 Identity:88/152 - (57%)
Similarity:117/152 - (76%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 80
            :||..|||||.:|||||||||:.:||.|||:||||||.:|....||:..:|||.||..||||.||
plant    84 LAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNGL 148

  Fly    81 VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKE 145
            .::::||||:.|||||..|::.||:::|||:|..|.|||||||..:.||||||||||..|:|:.|
plant   149 CDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGPETAKDE 213

  Fly   146 IALWFNEKELVTWTPAAKDWIY 167
            |:|||..:|||::|..::.|:|
plant   214 ISLWFKPQELVSYTSNSEKWLY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_476761.3 PTZ00093 19..167 CDD:173387 85/147 (58%)
NDPK3NP_192839.1 PLN02619 1..238 CDD:178228 88/152 (58%)

Return to query results.
Submit another query.