DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NDPK3

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_192839.1 Gene:NDPK3 / 826702 AraportID:AT4G11010 Length:238 Species:Arabidopsis thaliana


Alignment Length:152 Identity:88/152 - (57%)
Similarity:117/152 - (76%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 80
            :||..|||||.:|||||||||:.:||.|||:||||||.:|....||:..:|||.||..||||.||
plant    84 LAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNGL 148

  Fly    81 VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKE 145
            .::::||||:.|||||..|::.||:::|||:|..|.|||||||..:.||||||||||..|:|:.|
plant   149 CDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGPETAKDE 213

  Fly   146 IALWFNEKELVTWTPAAKDWIY 167
            |:|||..:|||::|..::.|:|
plant   214 ISLWFKPQELVSYTSNSEKWLY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 85/147 (58%)
NDK 21..155 CDD:278749 80/133 (60%)
NDPK3NP_192839.1 PLN02619 1..238 CDD:178228 88/152 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.