DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme5

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001072619.1 Gene:nme5 / 780075 XenbaseID:XB-GENE-951087 Length:214 Species:Xenopus tropicalis


Alignment Length:148 Identity:46/148 - (31%)
Similarity:71/148 - (47%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TMAANK---ERTFIMVKPDGVQRGLVGKIIERFE----QKGFKLVALKFTWASKELLEKHYADLS 72
            :|.|.|   |||..::|||.:.:.      |..|    :.||.:|..:....|.|.....|:|..
 Frog     4 SMKAPKIYVERTLAIIKPDVLHKA------EEIEDIILRCGFHIVQKRKVHLSPEQCSDFYSDQY 62

  Fly    73 ARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATN---PADSLPGTIRGDFCIQVGRNIIH 134
            .:.|||.|..||:|||::.|.....|.:...::::|.||   ..::.|.::|..:.....||.:|
 Frog    63 GKMFFPSLTAYMSSGPIIAMTLARYNAISYWKELIGPTNSLKAKETHPESLRAIYGTDDLRNALH 127

  Fly   135 GSDAVESAEKEIALWFNE 152
            ||....|||:||...|.|
 Frog   128 GSYCFTSAEREIRFMFPE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 44/144 (31%)
NDK 21..155 CDD:278749 43/139 (31%)
nme5NP_001072619.1 NDPk5 13..144 CDD:239880 41/136 (30%)
Dpy-30 160..197 CDD:310056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.