DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme8

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_853622.2 Gene:Nme8 / 73412 MGIID:1920662 Length:586 Species:Mus musculus


Alignment Length:151 Identity:36/151 - (23%)
Similarity:72/151 - (47%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SATMAANKE--------RTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYA 69
            |:..||.||        .|..::||....:..: :|::..::.||:|..:|....:.|...|.|.
Mouse   432 SSKAAAEKEIAHFFPPQSTLALIKPHVTHKERM-EILKTIKEAGFELTLMKEMHLTPEHANKIYF 495

  Fly    70 DLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADS---LPGTIRGDFCIQVGRN 131
            .::.:.|:..::..::.|..:.||....|.|...|:|:|..:|.::   .|.::|..:.:.:.||
Mouse   496 KITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRN 560

  Fly   132 IIHGSDAVESAEKEIALWFNE 152
            .:||:.....|.:.|:..|.|
Mouse   561 AVHGASNFSEASEIISNVFTE 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 33/145 (23%)
NDK 21..155 CDD:278749 32/143 (22%)
Nme8NP_853622.2 TRX_NDPK 11..113 CDD:239246
NDPk 155..301 CDD:260363
NDK 1 157..254
NDK 2 312..452 6/19 (32%)
NDK 313..450 CDD:197791 5/17 (29%)
NDPk_TX 313..445 CDD:239879 5/12 (42%)
NDK 448..581 CDD:197791 30/133 (23%)
NDPk 448..579 CDD:260363 29/131 (22%)
NDK 3 453..586 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.