DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme4

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_012825969.1 Gene:nme4 / 734101 XenbaseID:XB-GENE-5926500 Length:187 Species:Xenopus tropicalis


Alignment Length:156 Identity:87/156 - (55%)
Similarity:116/156 - (74%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFF 77
            |:.:|...|||.|.||||||||.|||:||:||||:||.||.||...||:.:|.:||.||..:||:
 Frog    31 SSAVAGVCERTLIAVKPDGVQRKLVGEIIKRFEQRGFTLVGLKLLQASEGILAEHYHDLRRKPFY 95

  Fly    78 PGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESA 142
            |.|:.||.|||||.|||||.|||:|.|.|:|.|:.:.:.||||||||.:.:.||:||.||:||.|
 Frog    96 PALLRYMASGPVVAMVWEGHNVVRTSRAMVGDTDSSQAKPGTIRGDFSVHISRNVIHASDSVEVA 160

  Fly   143 EKEIALWFNEKELVTWTPAAKDWIYE 168
            |:||:|||:..||::|..:.:..:|:
 Frog   161 EREISLWFHSGELISWETSDQSHLYQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 84/147 (57%)
NDK 21..155 CDD:278749 81/133 (61%)
nme4XP_012825969.1 NDPk_I 39..168 CDD:239876 79/128 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.