DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme5

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_003751808.1 Gene:Nme5 / 688903 RGDID:1583004 Length:211 Species:Rattus norvegicus


Alignment Length:161 Identity:47/161 - (29%)
Similarity:78/161 - (48%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQ-------KGFKLVALKFTWASKELLEKHYADLSARPFFP 78
            |:|..::|||         |:::.|:       .||.::..:....|.|.....|.:...:.|||
  Rat    13 EKTLALIKPD---------IVDKEEEIRDIILRSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFP 68

  Fly    79 GLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL------PGTIRGDFCIQVGRNIIHGSD 137
            .|..||:|||:|.|:....|.:...:::||   ||:||      |.::|..:.....||.:|||:
  Rat    69 NLTAYMSSGPLVAMILARHNAISYWKELLG---PANSLLAKETHPDSLRAIYGTDELRNALHGSN 130

  Fly   138 AVESAEKEIALWFNEK--ELVTWTPAAKDWI 166
            ...::|:||...|.|.  |.:....||||::
  Rat   131 DFAASEREIRFMFPEVIIEPIPIGQAAKDYL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 47/161 (29%)
NDK 21..155 CDD:278749 42/148 (28%)
Nme5XP_003751808.1 NDPk5 13..144 CDD:239880 40/142 (28%)
Dpy-30 156..197 CDD:398726 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.