DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme4

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001102948.1 Gene:Nme4 / 685679 RGDID:1591334 Length:185 Species:Rattus norvegicus


Alignment Length:139 Identity:77/139 - (55%)
Similarity:103/139 - (74%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYM 84
            :|||.:.||||||||.|||.:|.|||::|||||.:|...|.:.:|.:||.||..:||:|.|::||
  Rat    35 QERTLVAVKPDGVQRRLVGTVIHRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYM 99

  Fly    85 NSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALW 149
            :|||||.|||||.|||...|.|:|.|:..::.||||||||.:.:.||:||.||:|:.|::||.||
  Rat   100 SSGPVVAMVWEGHNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIELW 164

  Fly   150 FNEKELVTW 158
            |...||:.|
  Rat   165 FQSSELLNW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 77/139 (55%)
NDK 21..155 CDD:278749 74/133 (56%)
Nme4NP_001102948.1 NDPk_I 36..165 CDD:239876 72/128 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.