| Sequence 1: | NP_476761.3 | Gene: | awd / 43739 | FlyBaseID: | FBgn0000150 | Length: | 168 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018146.1 | Gene: | NME1-NME2 / 654364 | HGNCID: | 33531 | Length: | 267 | Species: | Homo sapiens |
| Alignment Length: | 35 | Identity: | 9/35 - (25%) |
|---|---|---|---|
| Similarity: | 18/35 - (51%) | Gaps: | 2/35 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 576 LAQFRFCGCGWPQHMLVPKGSPEGVQFDLFAMVTD 610 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| awd | NP_476761.3 | PTZ00093 | 19..167 | CDD:173387 | |
| NME1-NME2 | NP_001018146.1 | NDPk_I | 5..114 | CDD:239876 | |
| PTZ00093 | 118..266 | CDD:173387 | 3/16 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||