DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NME1-NME2

DIOPT Version :10

Sequence 1:NP_476761.3 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001018146.1 Gene:NME1-NME2 / 654364 HGNCID:33531 Length:267 Species:Homo sapiens


Alignment Length:35 Identity:9/35 - (25%)
Similarity:18/35 - (51%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 LAQFRFCGCGWPQHMLVPKGSPEGVQFDLFAMVTD 610
            |..::|...|...::.:|:...|.||.:  .::||
Human   249 LTGYKFQPTGNNPYLQLPQEDEEDVQME--QVMTD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_476761.3 PTZ00093 19..167 CDD:173387
NME1-NME2NP_001018146.1 NDPk_I 5..114 CDD:239876
PTZ00093 118..266 CDD:173387 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.