DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme4

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_006524740.1 Gene:Nme4 / 56520 MGIID:1931148 Length:223 Species:Mus musculus


Alignment Length:156 Identity:77/156 - (49%)
Similarity:104/156 - (66%) Gaps:17/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYM 84
            :|||.:.||||||||.|||.:|:|||::|||||.:|...|.:.:|.:||.||..:||:|.|::||
Mouse    56 QERTLVAVKPDGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYM 120

  Fly    85 NSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVG-----------------RNI 132
            :|||||.|||||.|||...|.|:|.|:..::.||||||||.:.:.                 ||:
Mouse   121 SSGPVVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISSACRSQKRVLDAWSQSYRNV 185

  Fly   133 IHGSDAVESAEKEIALWFNEKELVTW 158
            ||.||:|:.|::||.|||...||:.|
Mouse   186 IHASDSVDGAQREIELWFQSSELLNW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 77/156 (49%)
NDK 21..155 CDD:278749 74/150 (49%)
Nme4XP_006524740.1 NDPk_I 57..203 CDD:239876 72/145 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.