DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and Nme6

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_061227.1 Gene:Nme6 / 54369 MGIID:1861676 Length:189 Species:Mus musculus


Alignment Length:165 Identity:45/165 - (27%)
Similarity:76/165 - (46%) Gaps:29/165 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SVISATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKF--------TWASKELLEK 66
            |::.:..|.  :.|..::|||.|...|   |:|...|   ::::.||        .|..:: ..:
Mouse     3 SILRSPQAL--QLTLALIKPDAVAHPL---ILEAVHQ---QILSNKFLIVRTRELQWKLED-CRR 58

  Fly    67 HYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADS---LPGTIRGDFCIQV 128
            .|.:...|.|:..||.:|.|||:...:....:.::..|.::|.|....:   .|.:|||...:..
Mouse    59 FYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTD 123

  Fly   129 GRNIIHGSDAVESAEKEIAL---------WFNEKE 154
            .||..||||:|.||.:|||.         |:.|:|
Mouse   124 TRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 43/156 (28%)
NDK 21..155 CDD:278749 43/154 (28%)
Nme6NP_061227.1 NDPk6 12..146 CDD:239877 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.