DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NME3

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_011520805.1 Gene:NME3 / 4832 HGNCID:7851 Length:170 Species:Homo sapiens


Alignment Length:186 Identity:71/186 - (38%)
Similarity:90/186 - (48%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGTILAFF-SVISATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELL 64
            |:..:|..| ::..|......||||:.||||||||.|||:|:.|||:|||||||||.        
Human     1 MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKL-------- 57

  Fly    65 EKHYADLSARP-------FFPGLVNYMNSGPVVPM-------VWEGLN---VVKTGRQMLGATNP 112
                ..:.|||       ..|..||..::..:..:       .|.|..   ....||.....|.|
Human    58 ----VQVGARPPRSCCVSTTPSCVNARSTAALSSIWPPGRWWPWYGRGWTWCAPRGRSSEPRTRP 118

  Fly   113 ADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE 168
            ... |....|   |...||:|||||:||||.:||||||...||:.|..:|..|:||
Human   119 TPR-PAPSAG---ISASRNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 65/164 (40%)
NDK 21..155 CDD:278749 60/150 (40%)
NME3XP_011520805.1 NDPk 22..169 CDD:260363 65/162 (40%)
NDK 22..157 CDD:278749 60/150 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.