DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and NME1

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_937818.1 Gene:NME1 / 4830 HGNCID:7849 Length:177 Species:Homo sapiens


Alignment Length:156 Identity:119/156 - (76%)
Similarity:135/156 - (86%) Gaps:1/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFF 77
            :.|| ||.|||||.:|||||||||||:||:|||||||:||.|||..||::||::||.||..||||
Human    23 TGTM-ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFF 86

  Fly    78 PGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESA 142
            .|||.||:|||||.|||||||||||||.|||.||||||.|||||||||||||||||||||:||||
Human    87 AGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESA 151

  Fly   143 EKEIALWFNEKELVTWTPAAKDWIYE 168
            ||||.|||:.:|||.:|..|::||||
Human   152 EKEIGLWFHPEELVDYTSCAQNWIYE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 113/147 (77%)
NDK 21..155 CDD:278749 106/133 (80%)
NME1NP_937818.1 PTZ00093 30..176 CDD:173387 112/145 (77%)
NDK 30..164 CDD:278749 106/133 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 224 1.000 Domainoid score I2566
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - otm40673
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2206
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.