DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme2

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001005140.1 Gene:nme2 / 448725 XenbaseID:XB-GENE-923233 Length:154 Species:Xenopus tropicalis


Alignment Length:153 Identity:118/153 - (77%)
Similarity:135/153 - (88%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 80
            ||||||||||.:|||||||||:|:||:|||||||.|||:||..|||:||::||.||..|||:|||
 Frog     1 MAANKERTFIAIKPDGVQRGLMGEIIKRFEQKGFYLVAMKFVQASKDLLKQHYIDLKDRPFYPGL 65

  Fly    81 VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKE 145
            |:||:||||:.|||||||||||||.|||.||||||.|||||||||||||||||||||:||||.||
 Frog    66 VDYMSSGPVLAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESANKE 130

  Fly   146 IALWFNEKELVTWTPAAKDWIYE 168
            |||||.:||||.:...|.:|:||
 Frog   131 IALWFEDKELVEYKCCAHEWVYE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 113/147 (77%)
NDK 21..155 CDD:278749 106/133 (80%)
nme2NP_001005140.1 PTZ00093 4..152 CDD:173387 113/147 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2479
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3184
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - oto102819
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2206
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.