DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme3

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_012825767.1 Gene:nme3 / 448695 XenbaseID:XB-GENE-999215 Length:188 Species:Xenopus tropicalis


Alignment Length:148 Identity:95/148 - (64%)
Similarity:117/148 - (79%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMN 85
            ||||:.:||||.||.|:|:||.|||:|||.|||:|...||::||::||..|..:||:..||.||.
 Frog    41 ERTFLAIKPDGYQRRLIGEIIRRFEKKGFHLVAMKIMQASEQLLKQHYIALQDKPFYDRLVKYMG 105

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWF 150
            |||||.|||:||:||||.|.|:|.||||.|||||||||||:.||||:|||||:.|||::||||||
 Frog   106 SGPVVAMVWQGLDVVKTARLMIGETNPAHSLPGTIRGDFCVDVGRNVIHGSDSRESAQREIALWF 170

  Fly   151 NEKELVTWTPAAKDWIYE 168
            ...|||.|..:.:.||||
 Frog   171 QPDELVCWQDSTESWIYE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 92/145 (63%)
NDK 21..155 CDD:278749 87/133 (65%)
nme3XP_012825767.1 NDPk 41..187 CDD:260363 92/145 (63%)
NDK 41..175 CDD:278749 87/133 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.