DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme5

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002516.1 Gene:nme5 / 436789 ZFINID:ZDB-GENE-040718-221 Length:217 Species:Danio rerio


Alignment Length:154 Identity:45/154 - (29%)
Similarity:72/154 - (46%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMN 85
            |||..::|||.:.:  ..:|.:...|.||.::..:....|.|.....||:...:..||.|..:|:
Zfish    18 ERTLALIKPDAIHK--TDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMS 80

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADSL------PGTIRGDFCIQVGRNIIHGSDAVESAEK 144
            |||||.:.......:.|.:.::|   |..|:      |..:|..|.....||.:|||:...:||:
Zfish    81 SGPVVALALARDQAIATWKAIMG---PVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAER 142

  Fly   145 EIALWFNEK--ELVTWTPAAKDWI 166
            ||...|...  |.:....||||::
Zfish   143 EIRFMFPHSVIEPIPMGEAAKDYL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 45/154 (29%)
NDK 21..155 CDD:278749 40/141 (28%)
nme5NP_001002516.1 NDK 18..153 CDD:278749 40/139 (29%)
NDPk5 18..149 CDD:239880 39/135 (29%)
Dpy-30 161..202 CDD:253069 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.