DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nmdyn-D7

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster


Alignment Length:148 Identity:35/148 - (23%)
Similarity:61/148 - (41%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLV-NY 83
            |..|..::||..::.||:|.||......||:|.|::....::...|:.|      ..:.|:| .|
  Fly   245 KNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------EVYRGVVPEY 303

  Fly    84 MNSGPVVPMVWEGLNVV----------KTGRQMLGATNPADS------LPGTIRGDFCIQVGRNI 132
            :   |:|..:..|:.:.          ||.|:......|.|.      .|.|:|..|.....:|.
  Fly   304 I---PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNA 365

  Fly   133 IHGSDAVESAEKEIALWF 150
            :|.:|..:.:..|:...|
  Fly   366 VHCTDLPDDSNLELQYMF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 35/148 (24%)
NDK 21..155 CDD:278749 34/147 (23%)
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 34/147 (23%)
NDPk7B 246..383 CDD:239875 33/145 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.