DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme4

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_957489.1 Gene:nme4 / 394170 ZFINID:ZDB-GENE-040426-1043 Length:190 Species:Danio rerio


Alignment Length:138 Identity:80/138 - (57%)
Similarity:105/138 - (76%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMN 85
            |||.:.||||||||.|:|::|:||||:||:||.||...|..:||.:||..|..:||:..|:.||.
Zfish    42 ERTLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQHYVSLQKKPFYSSLLYYMT 106

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWF 150
            |||:|.|||||.|||||.|.|:|.|:||.:.||||||||.:.:.||::|.||:||.|::||:|||
Zfish   107 SGPIVAMVWEGHNVVKTSRMMVGDTDPAAAAPGTIRGDFSVHISRNVVHASDSVEGAQREISLWF 171

  Fly   151 NEKELVTW 158
            :..|||.|
Zfish   172 HRSELVDW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 80/138 (58%)
NDK 21..155 CDD:278749 76/133 (57%)
nme4NP_957489.1 NDK 42..176 CDD:278749 76/133 (57%)
NDPk_I 42..171 CDD:239876 74/128 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.