DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme2a

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_021335706.1 Gene:nme2a / 335716 ZFINID:ZDB-GENE-030131-7656 Length:178 Species:Danio rerio


Alignment Length:154 Identity:106/154 - (68%)
Similarity:126/154 - (81%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SATMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFF 77
            :|.|:.|:|||||.:|||||||||||:||:|||||||||||:|...|.::||.:||:||..||||
Zfish    23 TAPMSGNEERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFF 87

  Fly    78 PGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESA 142
            ||||:||::||||.|||||.||:||||.|||.|||.||.|||||||||:|||||||||||:||||
Zfish    88 PGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVGRNIIHGSDSVESA 152

  Fly   143 EKEIALWFNEKELVTWTPAAKDWI 166
            ..||.|||...|:..:|...:.||
Zfish   153 NTEINLWFKPDEICDYTKCQESWI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 104/148 (70%)
NDK 21..155 CDD:278749 99/133 (74%)
nme2aXP_021335706.1 PTZ00093 29..176 CDD:173387 102/146 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585942
Domainoid 1 1.000 216 1.000 Domainoid score I2646
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39553
Inparanoid 1 1.050 235 1.000 Inparanoid score I3366
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - otm26041
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.