DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme2b.2

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_571002.1 Gene:nme2b.2 / 30084 ZFINID:ZDB-GENE-000210-33 Length:153 Species:Danio rerio


Alignment Length:153 Identity:99/153 - (64%)
Similarity:125/153 - (81%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGL 80
            ||...|||||.||||||||||:|:||:|||||||:|||.||..||::|.::||.||..:||:.||
Zfish     1 MAGKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGL 65

  Fly    81 VNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKE 145
            |.|.:|||::.||||||||:||||.|||.|:|..|.||||||||||:||||:|||||:.:||..|
Zfish    66 VKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASKPGTIRGDFCIEVGRNLIHGSDSEKSAATE 130

  Fly   146 IALWFNEKELVTWTPAAKDWIYE 168
            ::|||..:|||::...|::||||
Zfish   131 VSLWFKPEELVSYRSCAQEWIYE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 94/147 (64%)
NDK 21..155 CDD:278749 89/133 (67%)
nme2b.2NP_571002.1 NDPk 6..152 CDD:260363 94/145 (65%)
NDK 6..140 CDD:278749 89/133 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2646
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3366
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - otm26041
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - O PTHR11349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.