DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and ndk1

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_592857.1 Gene:ndk1 / 2543111 PomBaseID:SPAC806.07 Length:151 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:86/148 - (58%)
Similarity:109/148 - (73%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMN 85
            |:|||.||||.|||||:|.||.:||.||:||.||||...|::|:|:|||:...:||:..||.:|.
pombe     4 EQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKLVGFMA 68

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWF 150
            ||||..|:|||...|||||.||||:||.||.|||||||:.|.:|||:.||||::|||.:||.|||
pombe    69 SGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIRGDYGIDLGRNVCHGSDSIESANREIKLWF 133

  Fly   151 NEKELVTWTPAAKDWIYE 168
            ...|:..:....:.||||
pombe   134 QPSEIQVYDRTIEPWIYE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 83/145 (57%)
NDK 21..155 CDD:278749 81/133 (61%)
ndk1NP_592857.1 NDPk 2..150 CDD:260363 83/145 (57%)
NDK 4..138 CDD:278749 81/133 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 175 1.000 Domainoid score I862
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39553
Inparanoid 1 1.050 185 1.000 Inparanoid score I1090
OMA 1 1.010 - - QHG61064
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - oto100746
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - LDO PTHR11349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2206
SonicParanoid 1 1.000 - - X354
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.