DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and R05G6.5

DIOPT Version :10

Sequence 1:NP_476761.3 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_501212.1 Gene:R05G6.5 / 187622 WormBaseID:WBGene00019899 Length:188 Species:Caenorhabditis elegans


Alignment Length:64 Identity:12/64 - (18%)
Similarity:30/64 - (46%) Gaps:15/64 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLN 98
            |::.|.::.|:              ::|::|...|||.::..: .|.:.:..||.:.::.:..|
 Worm    45 GIIEKTVKHFK--------------TEEVMEWKSADLESQDIW-NLSDRLIDGPCMLLLCQRAN 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_476761.3 PTZ00093 19..167 CDD:173387 12/64 (19%)
R05G6.5NP_501212.1 Dpy-30 147..188 CDD:428357
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.