DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and ndk-1

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001379178.1 Gene:ndk-1 / 172939 WormBaseID:WBGene00009119 Length:153 Species:Caenorhabditis elegans


Alignment Length:152 Identity:101/152 - (66%)
Similarity:119/152 - (78%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVN 82
            :|.|||||.:|||||.||||||||.|||::|:||||||...|||..||.||.||..:||||.|:.
 Worm     2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIE 66

  Fly    83 YMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIA 147
            ||:|||||.|||:||:|||.||.|||||||..|.|||||||||||.||||.||||||:||.:|||
 Worm    67 YMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIA 131

  Fly   148 LWFNEKELVTW-TPAAKDWIYE 168
            .||.::|:..: :|....|:||
 Worm   132 HWFKQEEINDYASPFINSWVYE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 99/148 (67%)
NDK 21..155 CDD:278749 95/133 (71%)
ndk-1NP_001379178.1 NDPk 3..152 CDD:351036 99/148 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162085
Domainoid 1 1.000 200 1.000 Domainoid score I1780
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39553
Inparanoid 1 1.050 209 1.000 Inparanoid score I2388
Isobase 1 0.950 - 0 Normalized mean entropy S158
OMA 1 1.010 - - QHG61064
OrthoDB 1 1.010 - - D1334716at2759
OrthoFinder 1 1.000 - - FOG0001003
OrthoInspector 1 1.000 - - oto20701
orthoMCL 1 0.900 - - OOG6_100304
Panther 1 1.100 - - LDO PTHR11349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2206
SonicParanoid 1 1.000 - - X354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.890

Return to query results.
Submit another query.