DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment awd and nme6

DIOPT Version :9

Sequence 1:NP_001287625.1 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001123709.1 Gene:nme6 / 100170458 XenbaseID:XB-GENE-969918 Length:179 Species:Xenopus tropicalis


Alignment Length:141 Identity:43/141 - (30%)
Similarity:73/141 - (51%) Gaps:6/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TFIMVKPDGVQRGLVGKII-ERFEQKGFKLVALK-FTWASKELLEKHYADLSARPFFPGLVNYMN 85
            |..::|||.|...::.:.: ::..:..|.::..| ..|.|.: .::.|.:...|.|:..||.:|:
 Frog    13 TLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTD-SQRFYCEHKGRFFYQRLVEFMS 76

  Fly    86 SGPVVPMVWEGLNVVKTGRQMLGATNPADS---LPGTIRGDFCIQVGRNIIHGSDAVESAEKEIA 147
            |||:...:....:.|:..|.::|.|....:   .|||:|||..:...||..||||:||||.:||.
 Frog    77 SGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREIT 141

  Fly   148 LWFNEKELVTW 158
            .:|.|.....|
 Frog   142 FFFPEFNTSDW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
awdNP_001287625.1 PTZ00093 19..167 CDD:173387 43/141 (30%)
NDK 21..155 CDD:278749 42/136 (31%)
nme6NP_001123709.1 NDPk6 11..145 CDD:239877 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.