DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1896 and PDCD7

DIOPT Version :9

Sequence 1:NP_651886.1 Gene:CG1896 / 43738 FlyBaseID:FBgn0039870 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_005698.1 Gene:PDCD7 / 10081 HGNCID:8767 Length:485 Species:Homo sapiens


Alignment Length:324 Identity:73/324 - (22%)
Similarity:117/324 - (36%) Gaps:96/324 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PHKKH---RLSEVKAKIQQVISSLGQL--------EQQSCGAGRDFDVHRAEELQRSTATLLDEL 57
            |.:.|   .|.||:|::.:.:..:.:|        |.::.||.......:...|:...|..|..|
Human   162 PQRTHAGPSLGEVRARLLRALRLVRRLRGLSQALREAEADGAAWVLLYSQTAPLRAELAERLQPL 226

  Fly    58 DQVPGQQVVDEQKQRKRRRRLYRRSQHRVIRATVKSEAA-----EQKFS----------IEPPRN 107
            .|.........:.:|.|||||..|.:.|...|..::|||     ||:..          .|..|.
Human   227 TQAAYVGEARRRLERVRRRRLRLRERAREREAEREAEAARAVEREQEIDRWRVKCVQEVEEKKRE 291

  Fly   108 TALEQAKHISL----RKQRDAASILETFDLLEKLCESR--GGDRAALC------QKLTH------ 154
            ..|:.|....|    :||.|...:::....||||.:.|  ...|..:|      :..||      
Human   292 QELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRLR 356

  Fly   155 ----------------MRLVWRRVQEETQAGHV-----KESKKVASLESQWKAVFFG-------- 190
                            :|::....|||.:...:     ||.:|:...:.:.::..||        
Human   357 KLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLA 421

  Fly   191 --------------RSLPTPKLNKGKFLEIRSTWDSYI--SYCGRGSSIPRGWVLPPTKPTAQW 238
                          .|||.       .::||..||.|:  |...:|:.:|:||||||......|
Human   422 HLLEPFRQYYLQAEHSLPA-------LIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIW 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1896NP_651886.1 PDCD7 <160..242 CDD:292640 26/108 (24%)
PDCD7NP_005698.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
PDCD7 191..481 CDD:318278 66/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.