DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and KIS

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001189640.1 Gene:KIS / 817592 AraportID:AT2G30410 Length:113 Species:Arabidopsis thaliana


Alignment Length:107 Identity:42/107 - (39%)
Similarity:63/107 - (58%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVIQECIMMVPDSKRR 70
            ||.|.||:...:|:.:|.:.|.|||..|.|:...::..|||.:.|::||.|:.|..||:||..:|
plant     4 IRNLKIKTSTCKRIVKELHSYEKEVEREAAKTADMKDKGADPYDLKQQENVLGESRMMIPDCHKR 68

  Fly    71 LQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAK---AELE 109
            |:.....|:..||   :|.|||. |:..|| :|||   |::|
plant    69 LESALADLKSTLA---ELEETDE-KEGPEI-EDAKKTVADVE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 32/84 (38%)
KISNP_001189640.1 TBCA 7..90 CDD:397219 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4086
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2540
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471374at2759
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 1 1.000 - - oto2952
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4256
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.