DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbca and TBCA

DIOPT Version :10

Sequence 1:NP_651885.1 Gene:Tbca / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001284667.1 Gene:TBCA / 6902 HGNCID:11579 Length:129 Species:Homo sapiens


Alignment Length:85 Identity:36/85 - (42%)
Similarity:60/85 - (70%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVIQECIMMVP 65
            |.|||:||:.||:|||:||.:||..|.||...::.::||:|.:..:::.::||.|::||..||:|
Human     1 MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIP 65

  Fly    66 DSKRRLQKEYEVLEKYLADE 85
            |.:|||:..|..|::.|..:
Human    66 DCQRRLEAAYLDLQRILVSK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbcaNP_651885.1 TBCA 4..101 CDD:460769 34/82 (41%)
TBCANP_001284667.1 TBCA 4..84 CDD:460769 34/79 (43%)

Return to query results.
Submit another query.