DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and tbca

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_957348.1 Gene:tbca / 394029 ZFINID:ZDB-GENE-040426-962 Length:108 Species:Danio rerio


Alignment Length:107 Identity:45/107 - (42%)
Similarity:72/107 - (67%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVIQECIMMVP 65
            |.||||||:.||:|||:||.:|:..|.||...::.::|:|:.:..|:::::||.||:||..||:|
Zfish     1 MADPRIRQIKIKTGVVKRLAKEEVLYIKEAKQQEEKIERLKAEAGDEYLIKKQMEVLQESRMMIP 65

  Fly    66 DSKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAE 107
            |..|||...:..|::.|..|::|.|.:.||:|..:|...|.|
Zfish    66 DCHRRLAMAHADLQQLLETEEELAEAEEYKEARTVLDSVKLE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 32/84 (38%)
tbcaNP_957348.1 TBCA 9..80 CDD:281033 28/70 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596682
Domainoid 1 1.000 77 1.000 Domainoid score I8856
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3388
Inparanoid 1 1.050 97 1.000 Inparanoid score I5024
OMA 1 1.010 - - QHG59154
OrthoDB 1 1.010 - - D1471374at2759
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 1 1.000 - - oto41089
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2310
SonicParanoid 1 1.000 - - X4256
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.