DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and Tbca

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_038958744.1 Gene:Tbca / 366995 RGDID:1311538 Length:144 Species:Rattus norvegicus


Alignment Length:53 Identity:22/53 - (41%)
Similarity:39/53 - (73%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQ 53
            |.|||:||:.||:|||:||.:||..|.||...::.::||::.:..:::.::||
  Rat    33 MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMKAEDGENYAIKKQ 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 16/45 (36%)
TbcaXP_038958744.1 TBCA 41..>87 CDD:397219 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354386
Domainoid 1 1.000 80 1.000 Domainoid score I8398
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3388
Inparanoid 1 1.050 100 1.000 Inparanoid score I4899
OMA 1 1.010 - - QHG59154
OrthoDB 1 1.010 - - D1471374at2759
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 1 1.000 - - otm45457
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4256
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.