DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and alp31

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_594162.1 Gene:alp31 / 2543341 PomBaseID:SPAC8E11.07c Length:119 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:26/111 - (23%)
Similarity:56/111 - (50%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVIQECIMMVPDSKRR 70
            :|.||||:.||:|:.::......::...:.|::....:|.|...:..|:.|:::.:..:||:..|
pombe     5 VRSLVIKTNVVKRIIKDVELAHIDINEAEKRVQSKIDNGEDSAEIEHQKFVLKKHLEALPDALVR 69

  Fly    71 LQKEYEVLEKYLADE-----QDLIETDSY-KKAAEILKDAKAELET 110
            |:.....||...:|.     .:|.:.:.| :||.|:::..:....|
pombe    70 LRNATNDLESISSDSAYEGTPELEQANEYLEKAKEVIEKEQTNFPT 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 20/89 (22%)
alp31NP_594162.1 TBCA 8..95 CDD:281033 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.