DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and tbca-1

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_490959.1 Gene:tbca-1 / 171791 WormBaseID:WBGene00021475 Length:111 Species:Caenorhabditis elegans


Alignment Length:109 Identity:32/109 - (29%)
Similarity:63/109 - (57%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGA---DDHVLRKQEEVIQECIMMVPD 66
            :::.|.||:|.|:||.:|...|.|:|:.|:.:..:|..|..   :::|.:|.:::::|...||.|
 Worm     7 QLKALRIKTGTVQRLVKEVAYYEKQVVKEEQKAAQLAADATNEDEEYVAKKSKDIVKETANMVRD 71

  Fly    67 SKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAELET 110
            |:.||||.       :||.::.|.:.:|.:.|....:||..:::
 Worm    72 SQSRLQKA-------VADLRESIASGNYPEEAAEFVNAKTLVDS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 28/87 (32%)
tbca-1NP_490959.1 TBCA 11..99 CDD:281033 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167772
Domainoid 1 1.000 50 1.000 Domainoid score I7867
eggNOG 1 0.900 - - E1_KOG3470
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4078
Isobase 1 0.950 - 0 Normalized mean entropy S871
OMA 1 1.010 - - QHG59154
OrthoDB 1 1.010 - - D1471374at2759
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 1 1.000 - - oto20013
orthoMCL 1 0.900 - - OOG6_102635
Panther 1 1.100 - - LDO PTHR21500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2310
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.750

Return to query results.
Submit another query.