DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1890 and LOC103695172

DIOPT Version :9

Sequence 1:NP_651885.1 Gene:CG1890 / 43737 FlyBaseID:FBgn0039869 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001306574.1 Gene:LOC103695172 / 103695172 RGDID:9422868 Length:219 Species:Rattus norvegicus


Alignment Length:35 Identity:13/35 - (37%)
Similarity:22/35 - (62%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MMVPDSKRRLQKEYEVLEKYLADEQDLIETDSYKK 96
            ::|.|.:|:.:..|..|::.|..|:||.|.:.|||
  Rat   183 VLVTDCQRQFEAAYTALQQILESEKDLEEAEEYKK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1890NP_651885.1 TBCA 9..94 CDD:281033 10/31 (32%)
LOC103695172NP_001306574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102635
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.