powered by:
Protein Alignment CG1890 and LOC103695172
DIOPT Version :9
Sequence 1: | NP_651885.1 |
Gene: | CG1890 / 43737 |
FlyBaseID: | FBgn0039869 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001306574.1 |
Gene: | LOC103695172 / 103695172 |
RGDID: | 9422868 |
Length: | 219 |
Species: | Rattus norvegicus |
Alignment Length: | 35 |
Identity: | 13/35 - (37%) |
Similarity: | 22/35 - (62%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 MMVPDSKRRLQKEYEVLEKYLADEQDLIETDSYKK 96
::|.|.:|:.:..|..|::.|..|:||.|.:.|||
Rat 183 VLVTDCQRQFEAAYTALQQILESEKDLEEAEEYKK 217
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG1890 | NP_651885.1 |
TBCA |
9..94 |
CDD:281033 |
10/31 (32%) |
LOC103695172 | NP_001306574.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003240 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102635 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.