DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha2 and AT5G10630

DIOPT Version :9

Sequence 1:NP_524611.1 Gene:eEF1alpha2 / 43736 FlyBaseID:FBgn0000557 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001331942.1 Gene:AT5G10630 / 830928 AraportID:AT5G10630 Length:743 Species:Arabidopsis thaliana


Alignment Length:452 Identity:157/452 - (34%)
Similarity:252/452 - (55%) Gaps:46/452 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGIT 72
            :|:.::|||||||||.:|.|::..|.|.::.:.|:||||:..|||||.|||.||:...|||||||
plant   316 LNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAEERERGIT 380

  Fly    73 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK-NGQTREH 136
            :.:|:..|.:.:::|.::|:|||:||:.|||.|.:|||.|:|::.|..|.||||... .||||||
plant   381 MTVAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEAGFDNLKGQTREH 445

  Fly   137 ALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNM 201
            |.:....||:|:||.:||||..  .||:.|::.||:.|.|:::...:..:|:.::|:|.....|:
plant   446 ARVLRGFGVEQVIVAINKMDIV--GYSKERFDLIKQHVGSFLQSCRFKDSSLTWIPLSAMENQNL 508

  Fly   202 L-EPSEK--MPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVP 263
            : .||:.  ..|:            :|.||:||:|::..|.|...|||.:|:.|..:....|.|.
plant   509 VAAPSDNRLSSWY------------QGPCLLDAVDSVKSPDRDVSKPLLMPICDAVRSTSQGQVS 561

  Fly   264 V-GRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYVAG 327
            . |::|.|.::||..|...|......::|:|...:|.|.|..||||...::.:...::    :||
plant   562 ACGKLEAGAVRPGSKVMVMPSGDQGTIRSLERDSQACTIARAGDNVALALQGIDANQV----MAG 622

  Fly   328 DSKNNPPRGAADFTAQV------IVLNHPGQIANGYTPVL-------DCHTAHIACKFSEIKEKC 379
            |...:|     ||...|      :||     :..|.||:|       ..|.|..|....::....
plant   623 DVLCHP-----DFPVSVATHLELMVL-----VLEGATPILLGSQLEFHVHHAKEAATVVKLVAML 677

  Fly   380 DRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKSV 441
            |.:||:.|:..|:.:.:..:|::.:....|:|||:|.|...|||..:|...:|||:|.:..:
plant   678 DPKTGQPTKKSPRCLTAKQSAMLEVSLQNPVCVETFSESRALGRVFLRSSGRTVAMGKVTRI 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha2NP_524611.1 PTZ00141 1..450 CDD:185474 157/452 (35%)
AT5G10630NP_001331942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5256
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1150082at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.