DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and NOP16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_010917.3 Gene:NOP16 / 856719 SGDID:S000000804 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:52/223 - (23%)
Similarity:74/223 - (33%) Gaps:102/223 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NVNRKTMNKTRSSTGKI----KD----------PRMKKMWMEDQRVGTNFSEMGL-AK------- 57
            :|.::.||  |||.||.    ||          |.:...|.....:..|:.::|| ||       
Yeast     3 SVRKRKMN--RSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKKLGLRAKLQTPAGG 65

  Fly    58 ---DVNKAI-AIPSYKKDRLLAARVVNGFLEEELDEDE--------------------------- 91
               |::|.: .||..|.           .|:|:.||||                           
Yeast    66 KEADLSKVVKRIPLTKP-----------VLDEDEDEDEGEDEQNDYNAATVELDENEIPEGGARI 119

  Fly    92 ---------RRVLGLKKPV----------VEEGPKRGHVVQELEQLAS------ERADPEFRLPK 131
                     |.|.|.||..          ..:..:...||::||:|||      ||:..|     
Yeast   120 QRDKNGDVVRVVYGKKKNFDADEDVNEIKARDTTEETEVVKKLEELASRPVIRKERSQSE----- 179

  Fly   132 GVVKE---LSYFLNKHKFNYKAMVADRK 156
               :|   |.....||..:||.|..|:|
Yeast   180 ---REEEWLEKLYKKHGDDYKKMFFDKK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 52/223 (23%)
NOP16NP_010917.3 Nop16 5..222 CDD:401393 51/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.