DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and AT1G02870

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_563668.1 Gene:AT1G02870 / 839496 AraportID:AT1G02870 Length:193 Species:Arabidopsis thaliana


Alignment Length:186 Identity:36/186 - (19%)
Similarity:62/186 - (33%) Gaps:61/186 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ARKRYRYNVNRKTMNKTRSSTGKIKDPRMKK------------------MWMEDQRVGTNFSEMG 54
            ||.|.:|   |.:..|.|.:..| |:|.:.|                  .|.:...|..|:...|
plant     2 ARSRRKY---RNSRAKVRVALPK-KNPNIFKPAFNFPPKLRALMGDDVPEWDDQASVIQNYKSFG 62

  Fly    55 LAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQL- 118
            :..:.|            ||..|.    ..:.:.:|:.  |.:..||  |.|....:.:|.|.: 
plant    63 VISNPN------------LLGIRA----RTDHMIQDDS--LNVPPPV--EPPTDDPIAKEFEPID 107

  Fly   119 -ASERADPEFRLPKGVVKE-----------------LSYFLNKHKFNYKAMVADRK 156
             .||..:.:.:...|..::                 :...:.||..:.:.|..|||
plant   108 SGSELEEDDLKTALGKQRKDGKSAPLQPLTTMQRTHIRRLVEKHGDDIEGMYRDRK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 35/185 (19%)
AT1G02870NP_563668.1 Nop16 3..181 CDD:370477 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13243
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.