DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and NOP16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001243468.2 Gene:NOP16 / 51491 HGNCID:26934 Length:232 Species:Homo sapiens


Alignment Length:205 Identity:51/205 - (24%)
Similarity:93/205 - (45%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIRKNHARKRYRYNVNRKTMNKT--RSSTGKIKDPRMKKMWMEDQRVGTNFSEMGLAKDVNKAIA 64
            |.:....|:::.|:||||.:|:.  |.:..:|:...::..|...:.|..|.:|||||.|.|:|:.
Human     3 KAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVP 67

  Fly    65 IPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQLASERADPEFR- 128
            :   :|.::.|.         |:|.:||....::||.|            |..|.:|.:.||.: 
Human    68 L---RKRKVKAM---------EVDIEERPKELVRKPYV------------LNDLEAEASLPEKKG 108

  Fly   129 --LPKGVVKELSYFLNKHKFNYK-----AMVADRKNFGQWTWRQFRLKIRRFMS-IPEQFNVYLE 185
              |.:.::..:.|.:..|..:||     :.:..|:  |:|.|..:      |.| :|:     .|
Human   109 NTLSRDLIDYVRYMVENHGEDYKQSGKTSSILCRR--GRWRWSDW------FTSQLPQ-----AE 160

  Fly   186 QKKLPVGVKP 195
            ....||.::|
Human   161 ASPGPVKLEP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 43/173 (25%)
NOP16NP_001243468.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 9/27 (33%)
Nop16 16..131 CDD:312799 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4706
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5342
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52410
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 1 1.000 - - FOG0006842
OrthoInspector 1 1.000 - - oto90672
orthoMCL 1 0.900 - - OOG6_106310
Panther 1 1.100 - - LDO PTHR13243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.