DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and nop16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001002534.1 Gene:nop16 / 436807 ZFINID:ZDB-GENE-040718-267 Length:171 Species:Danio rerio


Alignment Length:186 Identity:49/186 - (26%)
Similarity:85/186 - (45%) Gaps:29/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIRKNHARKRYRYNVNRKTMNK--TRSSTGKIKDPRMKKMWMEDQRVGTNFSEMGLAKDVNKAIA 64
            ||:|:..|..:.||.|:|.:.|  .|.....|:.|:::|.|.|.:.|..|..:||||......:.
Zfish     3 KIKKSRKRNTFNYNKNKKKLKKKLRRKEKPHIECPQIRKAWDEHKTVKQNLQDMGLAPGTKGMLP 67

  Fly    65 IPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQLASERADPEFRL 129
            |...|..:              ::..|..||   ||         :|::|:|..||.|.:.....
Zfish    68 IKPKKNTK--------------VEPMETNVL---KP---------YVIEEMEAEASVRGNDRTTC 106

  Fly   130 PKGVVKELSYFLNKHKFNYKAMVADRKNFGQWTWRQFRLKIRRFMSI-PEQFNVYL 184
            ...:::.:.:.:.:|..:||||..|.||:.|.|.:|.:.|:..:... |||:..::
Zfish   107 STDMIEYVQHMVKEHNEDYKAMARDEKNYYQDTPKQIKRKVELYKRCHPEQYAAFI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 43/165 (26%)
nop16NP_001002534.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 10/30 (33%)
Nop16 37..148 CDD:286503 35/136 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..79 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4706
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5347
OMA 1 1.010 - - QHG52410
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 1 1.000 - - FOG0006842
OrthoInspector 1 1.000 - - oto39938
orthoMCL 1 0.900 - - OOG6_106310
Panther 1 1.100 - - LDO PTHR13243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.