DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and Nop16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001040560.1 Gene:Nop16 / 306768 RGDID:1305727 Length:178 Species:Rattus norvegicus


Alignment Length:201 Identity:62/201 - (30%)
Similarity:103/201 - (51%) Gaps:37/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIRKNHARKRYRYNVNRKTMNKT--RSSTGKIKDPRMKKMWMEDQRVGTNFSEMGLAKDVNKAIA 64
            |.:....|:::.||||||.:|:.  |.:..:|:...::..|...:.|..|.:|||||.|.|||:.
  Rat     3 KAKGKTRRQKFGYNVNRKRLNRNARRKAAPRIECSHIRHAWDHTKSVRQNLAEMGLAMDPNKAVP 67

  Fly    65 IPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQLASERADPEFR- 128
            :   :|.::.|.         |:|.:||....::||         :||.:||   :|.:.||.: 
  Rat    68 L---RKRKVKAM---------EVDTEERPKDLVRKP---------YVVNDLE---AEASLPEKKG 108

  Fly   129 --LPKGVVKELSYFLNKHKFNYKAMVADRKNFGQWTWRQFRLKI---RRFMSIPEQFNVY---LE 185
              |.:.::..:.|.:..|..:||||..|.||:.|.|.:|.|.||   :||  .|.::.|:   |:
  Rat   109 NTLSRDLIDYVHYMVENHGEDYKAMARDEKNYYQDTPKQIRNKINVYKRF--YPTEWQVFVASLQ 171

  Fly   186 QKKLPV 191
            .||:.|
  Rat   172 NKKMEV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 53/171 (31%)
Nop16NP_001040560.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 10/27 (37%)
Nop16 9..153 CDD:286503 52/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343844
Domainoid 1 1.000 43 1.000 Domainoid score I12071
eggNOG 1 0.900 - - E1_KOG4706
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5166
OMA 1 1.010 - - QHG52410
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 1 1.000 - - FOG0006842
OrthoInspector 1 1.000 - - oto97780
orthoMCL 1 0.900 - - OOG6_106310
Panther 1 1.100 - - LDO PTHR13243
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.