DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and nop16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_596824.1 Gene:nop16 / 2539893 PomBaseID:SPBC1539.10 Length:209 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:41/205 - (20%)
Similarity:74/205 - (36%) Gaps:85/205 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NRKTMNKTRSSTGKIKDPRM-------------------KKMWMEDQRVGTNFSEMGLAKDVNKA 62
            |.:..||.||  ||   ||:                   ::.|.:...:..|::.:||       
pombe     3 NPRQRNKQRS--GK---PRLTRRNANKKAKAKIYGNFVIQQNWDKHATLRQNYARLGL------- 55

  Fly    63 IAIPSY---------------KKDRLLAARVVNGFLEEELDE---------------DERRVL-- 95
            :|.|:|               .:||.|.:        |||||               |:..::  
pombe    56 LATPNYVTGGVEKLYPDPKRENEDRELTS--------EELDELKKSLPPGQAIVRRDDDGNIIEI 112

  Fly    96 --GLKKPV-------VEEGPKRGHVVQELEQLASERADPEFR--LPKGVVKE--LSYFLNKH-KF 146
              |..|.:       :...|.:..||::||:.|.::|..:..  ||....:.  :...:||: ..
pombe   113 IHGEAKTLDDVLDKEISIAPAKTEVVRQLEEEAVKKAARQSNKMLPLSAFEHAYIQRLINKYGTE 177

  Fly   147 NYKAMVADRK 156
            ::::|..|.|
pombe   178 DFESMAKDVK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 41/205 (20%)
nop16NP_596824.1 Nop16 5..189 CDD:286503 40/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.