DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and nol-16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_492248.1 Gene:nol-16 / 191277 WormBaseID:WBGene00013958 Length:189 Species:Caenorhabditis elegans


Alignment Length:171 Identity:50/171 - (29%)
Similarity:85/171 - (49%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HARKRYRYNVNRKTMNKTRSSTGKIKDPRMKKMWMEDQRVGTNFSEMGLAKDVNKAIAIPSYKKD 71
            :..:|.|....:|..||.:.|...:  |.:|..|.|.:....|..:||:|.:.|.|:.|..::|:
 Worm    13 YTNRRNRQKYLKKKDNKKKLSKSAV--PIIKYTWDETKTPRENVRDMGIAFNPNDAVPIAEHRKE 75

  Fly    72 RLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQLASE----RA--DPEFRLP 130
             ::.|..::| :...:.:.|::|.|.||    ...:..|::..|||...|    ||  |.:|||.
 Worm    76 -IIDAEPIDG-VSIVVPKPEKKVTGRKK----NEKQAAHIISNLEQQVKEEEEARAGQDRKFRLF 134

  Fly   131 KGVVKELSYFLNKHKFNYKAMVADRKNFGQWTWRQFRLKIR 171
            ....:...|.|.:|..:::||..|.||..|:|.:|:..|||
 Worm   135 HRETELCVYMLARHGEDFQAMTRDPKNLWQYTPKQWAKKIR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 50/169 (30%)
nol-16NP_492248.1 Nop16 38..175 CDD:286503 42/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4706
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3991
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52410
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 1 1.000 - - FOG0006842
OrthoInspector 1 1.000 - - oto18873
orthoMCL 1 0.900 - - OOG6_106310
Panther 1 1.100 - - LDO PTHR13243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.