DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and F49E2.5

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001360758.1 Gene:F49E2.5 / 181175 WormBaseID:WBGene00009888 Length:1316 Species:Caenorhabditis elegans


Alignment Length:151 Identity:37/151 - (24%)
Similarity:66/151 - (43%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GTNFSEMGLAKDVNKAIAIPSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVV--------E 103
            ||:.|:....|:|.|.:.....|.|.:    .::..::..:|....::...|.|.|        :
 Worm  1162 GTDMSQTQFQKNVEKLVQATLAKHDIV----EIDPTVKLRIDAQLIKLSEKKAPAVVMEHVNYIK 1222

  Fly   104 EGPKRGHVVQELEQLASERADPEFR-LPKGVVKELSYFLNKHKFNYKAMVADRKNFGQWTWRQFR 167
            ..|...||    .:.::...|..:: |||.:: ..:..::.|..||.||.||.:|..:.|.|..:
 Worm  1223 PLPMELHV----SRPSTPSRDRVYKLLPKDII-FCAGLMDSHGENYAAMAADERNIFKDTSRALQ 1282

  Fly   168 LKIRRFMSIPEQFNVYLEQKK 188
            .|||.|...| .::.||..|:
 Worm  1283 RKIRIFKESP-HYHTYLRAKE 1302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 32/134 (24%)
F49E2.5NP_001360758.1 DUF612 1..504 CDD:282585
rne <834..996 CDD:236766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.