DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11563 and nop16

DIOPT Version :9

Sequence 1:NP_651884.1 Gene:CG11563 / 43735 FlyBaseID:FBgn0039868 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001096218.1 Gene:nop16 / 100124769 XenbaseID:XB-GENE-991038 Length:168 Species:Xenopus tropicalis


Alignment Length:178 Identity:48/178 - (26%)
Similarity:81/178 - (45%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIRKNHARKRYRYNVNRKTMNKTRSSTGKIKDPR-----MKKMWMEDQRVGTNFSEMGLAKDVNK 61
            |::|... ..:.|||:||   |.:....|...||     ::..|.:.:.|..|.::||||.:.||
 Frog     3 KVKKKRG-NTFNYNVDRK---KLKRKARKKHAPRIPCEPIRSAWNDGKSVAKNLADMGLAANPNK 63

  Fly    62 AIAI-PSYKKDRLLAARVVNGFLEEELDEDERRVLGLKKPVVEEGPKRGHVVQELEQLASERADP 125
            ::.| ||..||               .:|...:|  :|||.|.||         |:.|||..:..
 Frog    64 SLPIRPSQVKD---------------AEEQPGKV--IKKPYVLEG---------LQALASLPSKQ 102

  Fly   126 EFRLPKGVVKELSYFLNKHKFNYKAMVADRKNFGQWTWRQFRLKIRRF 173
            ...:...:::.:.:.:..:..:||||..|.||:.|.|.:|.:.|:..:
 Frog   103 TMGISSDMIQYVRHMVENYGEDYKAMARDEKNYYQDTPKQIQRKVNLY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11563NP_651884.1 Nop16 9..173 CDD:401393 46/169 (27%)
nop16NP_001096218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..40 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..79 8/34 (24%)
Nop16 <74..148 CDD:370477 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5251
OMA 1 1.010 - - QHG52410
OrthoDB 1 1.010 - - D1431164at2759
OrthoFinder 1 1.000 - - FOG0006842
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13243
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.110

Return to query results.
Submit another query.