DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and SEC14L5

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:304 Identity:52/304 - (17%)
Similarity:106/304 - (34%) Gaps:104/304 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTH--------------- 70
            :::...|:. :.|......:...|.|..|..:.::.|:::|..:|:.|..               
Human   246 LIQLRHWLQ-ETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWRKQHQVDLLLQTWQPPAL 309

  Fly    71 LEEFFV------NLDCERP---------EIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNY 120
            ||||:.      ::| .||         :.:..|:.|           |...:|..:..:|    
Human   310 LEEFYAGGWHYQDID-GRPLYILRLGQMDTKGLMKAV-----------GEEALLRHVLSVN---- 358

  Fly   121 NFADVMKLYCMVFDFWMYEDG--------IQPGHVI-----VIDLKNTSLGHVARIGLLQMKKFL 172
                              |:|        .|.|..|     ::||:..::.|:.|.|:..:.:.:
Human   359 ------------------EEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMI 405

  Fly   173 YYLQEAAAIRLIGFHFINIVPFMDKIL-ALMTPFMKKELTTVLHMHSDLKEFYK-------FVPQ 229
            ..:::... ..:|...|...|.:..:| .|::||:.:.......::|...  |:       ::.:
Human   406 EVVEDNYP-ETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSGSN--YQGPGGLVDYLDR 467

  Fly   230 EMLPKEYGGQL-----EEANVAKEIYYKKLLDNRKEMIEFETRH 268
            |::|...||:.     |...|.|.:|          |.|.|..|
Human   468 EVIPDFLGGESVCNVPEGGLVPKSLY----------MTEEEQEH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 25/165 (15%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 7/42 (17%)
SEC14 306..479 CDD:214706 35/209 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.