DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11550 and YKL091C

DIOPT Version :9

Sequence 1:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:56/290 - (19%)
Similarity:108/290 - (37%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFPEIRRPE----------------VLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQV 60
            ::|:|..|.                :|:|.. |..:.:..:|..:...|.|..|.::.:..:.::
Yeast     8 TYPQICSPNALPGTPGNLTKEQEEALLQFRS-ILLEKNYKERLDDSTLLRFLRARKFDINASVEM 71

  Fly    61 LDTNLTARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGYR----------------VIL 109
            .   :......||:..|...|..|..:.......:.|....|:.|.                :.|
Yeast    72 F---VETERWREEYGANTIIEDYENNKEAEDKERIKLAKMYPQYYHHVDKDGRPLYFEELGGINL 133

  Fly   110 AKLDDLNTSNYNFADVMKLYCMVFDFWMYEDGIQPGHVI-----VIDLKNTSLGHVARIGLLQMK 169
            .|:..:.|......:::|.|.:...:.:.....:.|::|     |:|||..||.:...:      
Yeast   134 KKMYKITTEKQMLRNLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHV------ 192

  Fly   170 KFLYYLQEAAAI-------RLIGFHFINIVPF-MDKILALMTPFMKKELTTVLHM--HSDLKEFY 224
              |.|:::.|.|       |:..|:.|: .|| ...:..::.||:.....:.:.:  .|..||..
Yeast   193 --LSYIKDVADISQNYYPERMGKFYIIH-SPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELL 254

  Fly   225 KFVPQEMLPKEYGGQLEEANVAKEIYYKKL 254
            |.:|.|.||.:|||.....|...:.||..:
Yeast   255 KQIPIENLPVKYGGTSVLHNPNDKFYYSDI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 37/175 (21%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 7/48 (15%)
SEC14 101..271 CDD:214706 38/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.